DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33773 and CG33725

DIOPT Version :9

Sequence 1:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:185 Identity:57/185 - (30%)
Similarity:92/185 - (49%) Gaps:22/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAKRINLILAILIFYSIIKTNSR--FEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKL 63
            |.:|.:..||.:.:...:|..|..  |:|||..|.:.:.....|.||.||:::|.      |..|
  Fly     1 MLSKLVTSILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSRE------KVLL 59

  Fly    64 N-----QIPLPRMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNH 123
            |     ..|...:.|:..::|:.||::|:|.::..|||:||.. ..:|.::.|||.|..:|.:||
  Fly    60 NFNGTVLHPANNIIVHVKLFKKANGFKPWLLDVKLDACRFVRT-NFHPFVRIIFDLFKDFSTINH 123

  Fly   124 SCPYTSDLIVERLPIGFMNLRVTEILPFPEGNYLFE--FHFSRRKSIFASTQVYF 176
            :|||....:|:...:....|:    ||||.|:||..  :.|.:|...  .|.|.|
  Fly   124 TCPYVGLQVVKDFYLRPEKLK----LPFPSGDYLLSLIWIFDKRPQF--DTNVSF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 30/84 (36%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.