powered by:
Protein Alignment CG33773 and CG33630
DIOPT Version :9
Sequence 1: | NP_001027213.1 |
Gene: | CG33773 / 3772436 |
FlyBaseID: | FBgn0053773 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027166.1 |
Gene: | CG33630 / 3772504 |
FlyBaseID: | FBgn0053630 |
Length: | 212 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 11/63 - (17%) |
Similarity: | 23/63 - (36%) |
Gaps: | 29/63 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 CKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDLIVERLPIGFMNLRVTEIL--PFPEGNY 156
|:|:....:||:::.:|.. |:::.:|: |...|||
Fly 108 CEFLSEYNTNPMMEMMFKK---------------------------NVKLNDIIVCPVRVGNY 143
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33773 | NP_001027213.1 |
DUF1091 |
73..158 |
CDD:284008 |
11/63 (17%) |
CG33630 | NP_001027166.1 |
DM8 |
96..186 |
CDD:214778 |
11/63 (17%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45448178 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.