DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33773 and CG33643

DIOPT Version :9

Sequence 1:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:177 Identity:42/177 - (23%)
Similarity:69/177 - (38%) Gaps:43/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILAILIFYSI--IKTNSRFEFTNLNCTAFDLRVGEFENCNL-KSINRSY-------KYVSGKYKL 63
            :...||.|.:  .:.|.|....:::...||.:..|...|.: :|.||||       ....||:..
  Fly     7 LYCFLILYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRSYVNCHMLLNREVGKFDA 71

  Fly    64 NQIPLPRMKVNFIMWKRLNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCP-- 126
            ..:      ::|:   |.||....||....|||..:.:.:.|.::.....:|..:||:  .||  
  Fly    72 RNV------LDFV---RPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECPLK 125

  Fly   127 ----YTSDLIVERLPIGFMNLRVTE-ILP--FPEGNY--LFEFHFSR 164
                ||           ..||.:.| ..|  .|.|.:  |.||:.::
  Fly   126 ANFNYT-----------MKNLYMDEQDFPSFVPSGTFRSLIEFYLNQ 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 23/95 (24%)
CG33643NP_001027258.1 DUF1091 75..152 CDD:284008 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.