DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33773 and CG33137

DIOPT Version :9

Sequence 1:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:149 Identity:36/149 - (24%)
Similarity:64/149 - (42%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSIIKTNSRFEFTNLNCTAFDLRVGEFE---NCNLKSINRSYKYVS--GKYKLNQIPLPRMKVNF 75
            :.:.:.|..::..|:.|:.    |..|.   :|::::||.: |.|:  ..|.|.  ||..:.:.|
  Fly     5 FQLSEPNIVYKLKNIECST----VPGFSANASCHIRAINWN-KAVAEMDVYLLR--PLYNITIRF 62

  Fly    76 IMWKR--LNGYRPFLYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCPYTSDLIVER--- 135
            .:.|:  .|.::|||.::..:.|..:......|....|......:||.||||||...|:...   
  Fly    63 QILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYL 127

  Fly   136 --------LPIGFMNLRVT 146
                    .|:||....:|
  Fly   128 NESYLPNVFPLGFYKFNIT 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 22/87 (25%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.