DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33773 and CG13193

DIOPT Version :9

Sequence 1:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:151 Identity:30/151 - (19%)
Similarity:56/151 - (37%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RFEFTNLNCTAFDLRVGEFENCNLKSINRSYKYVSGKYKLN-QIPLPR-----MKVNFIMWKRLN 82
            |.:|||::.           .|:....:....:::.|.:|| .|.|.|     ::....:.:.::
  Fly    34 RSKFTNISV-----------ECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLID 87

  Fly    83 GYRPF--LYNITADACKFVENPKSNPVLKYIFDSFSAYSNMNHSCP------------YTSDLIV 133
            |...:  |::...|.||.:.....:.::|....:...|.|:...||            ..:..|.
  Fly    88 GKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIP 152

  Fly   134 ERLPIGFMNLRVTEILPFPEG 154
            ..||.||..|..|.....|:|
  Fly   153 GYLPAGFYRLHDTNYYGKPKG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 19/96 (20%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/83 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.