DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and NQR

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001185182.1 Gene:NQR / 841391 AraportID:AT1G49670 Length:652 Species:Arabidopsis thaliana


Alignment Length:244 Identity:67/244 - (27%)
Similarity:103/244 - (42%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMAREDMKKYFDEVMVQMDY 85
            ||:.::...| ||..  |....|.||             |...||| .|.|:...||:.:.....
plant    45 ETTSLVREAN-AKFH--QGLSFPSAI-------------FVKCDVT-NRGDLLAAFDKHLATFGT 92

  Fly    86 IDVLINGATLC-----DENNIDA------TINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTS 139
            :|:.||.|.:.     |:::.|.      |||.:|..::......:..|..|.  ..|:|:|:.|
plant    93 LDICINNAGISTPLRFDKDDTDGSKSWKHTINVDLIAVVEGTQLAIKAMKAKQ--KPGVIINMGS 155

  Fly   140 VIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEYGQS 204
            ..||.|.||...|:|||.||:.||||||   ||.:.|:.:..:|  |.  |:..:|...::  .|
plant   156 AAGLYPMPVDPIYAASKAGVVLFTRSLA---YYRRQGIRINVLC--PE--FIKTDLAEAID--AS 211

  Fly   205 FADRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYW 253
            ..:.:.........:.|...:...|:.....:||..:.|||      ||
plant   212 ILESIGGYMSMDMLIKGAFELITDEKKAGACLWITKRRGLE------YW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 65/237 (27%)
adh_short 7..195 CDD:278532 56/184 (30%)
NQRNP_001185182.1 ADH_SDR_c_like 9..254 CDD:187584 65/242 (27%)
adh_short 9..210 CDD:278532 57/192 (30%)
CurA 285..639 CDD:225041
Mgc45594_like 286..640 CDD:176212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2961
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.