DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and RDH5

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001186700.1 Gene:RDH5 / 5959 HGNCID:9940 Length:318 Species:Homo sapiens


Alignment Length:224 Identity:50/224 - (22%)
Similarity:87/224 - (38%) Gaps:53/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ILQSTENPQAIAQLQSIKPSTQIFFWTYDVT--MAREDMKKYFDEVMVQMDYIDVLINGATLC-- 96
            :|.|...|.....||.: .|:::.....|:|  .:.:...|:. |:.|:...:..|:|.|.:.  
Human    55 VLASCLTPSGAEDLQRV-ASSRLHTTLLDITDPQSVQQAAKWV-EMHVKEAGLFGLVNNAGVAGI 117

  Fly    97 -------DENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCA--- 151
                   ..::....:|.|..|.:.....:||.:.:    ..|.::|:|||:|.     ..|   
Human   118 IGPTPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQ----ARGRVINITSVLGR-----LAANGG 173

  Fly   152 -YSASKFGVIGFTRSL-ADPLYYSQNGVAVMAVCCGPTRVFV------DRELKAF---------L 199
             |..||||:..|:.|| .|..::   |:.|..|..|..|..|      ::.|:|.         .
Human   174 GYCVSKFGLEAFSDSLRRDVAHF---GIRVSIVEPGFFRTPVTNLESLEKTLQACWARLPPATQA 235

  Fly   200 EYGQSFADRLRRAPCQSTSVCGQNIVNAI 228
            .||.:|..:..:..        |.|:|.|
Human   236 HYGGAFLTKYLKMQ--------QRIMNLI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 50/224 (22%)
adh_short 7..195 CDD:278532 41/180 (23%)
RDH5NP_001186700.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 50/224 (22%)
PRK08017 31..308 CDD:181198 50/224 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.