DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and cbr4

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001007873.1 Gene:cbr4 / 493259 XenbaseID:XB-GENE-5935857 Length:236 Species:Xenopus tropicalis


Alignment Length:248 Identity:60/248 - (24%)
Similarity:107/248 - (43%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCYV-ADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMAREDM 72
            ||.| ....||....||:|..::.....|.:..|    :|:..:.:....:.. :.||:...| :
 Frog     4 VCAVFGGSRGIGKAVSKLLAQRDYKVAVISRDLE----VAKAAAAEVGAHLAL-SCDVSKENE-I 62

  Fly    73 KKYFDEVMVQMDYIDVLINGATL--------CDENNIDATINTNLTGMMNTVATVLPYMDRKMGG 129
            :..|.|:...:..:|.|:|.|.:        ....:|.:.::.||.|.:.|....|..|.::.||
 Frog    63 QDTFKEITNNLGNVDYLVNSAGIRRDALLLRTRSEDIRSLLSVNLVGTIQTCKLALRSMIQQQGG 127

  Fly   130 TGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRE 194
            .   |||:.|::|...:.....|.|||.|:|||::|||..:  ::..:.|..|..|    |:..:
 Frog   128 A---IVNIGSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEV--AKRNIRVNVVAPG----FIHTD 183

  Fly   195 LKAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSE-NGQIWIADKGGLEL 246
            :...|| ..|....:............|:::..:|... .|.:.:.| |||:|
 Frog   184 MTLGLE-EDSLTKMVPLGRFGDPEEVAQSVLFLLESPYITGHVLVVD-GGLQL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 60/248 (24%)
adh_short 7..195 CDD:278532 49/194 (25%)
cbr4NP_001007873.1 NADB_Rossmann 3..232 CDD:389744 57/244 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.