DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and sro

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:216 Identity:56/216 - (25%)
Similarity:89/216 - (41%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HVCYVADCGGIALETSKVLMTKNIAK--LAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMARE 70
            |:..::.|..|..|.:|:|.....||  |:.:.:.|       |..::|.:        :.:...
  Fly    51 HMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLE-------LDLLEPDS--------IRLVHR 100

  Fly    71 DMKKYFDEVMVQMDY-IDVLINGA-TLCD-------ENNIDATINTNLTGMMNTVATVLPYMDRK 126
            .::   |.:.....| :..|||.| .:|.       ...|:|.||.||.|.|.....:||.:.::
  Fly   101 QLR---DILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLTHELLPLLRQQ 162

  Fly   127 MGGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFV 191
            .    |.|:||||..||...|....|:|||..:..:|.||...|  .|.|:.|:...  |....:
  Fly   163 Q----GRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVEL--QQYGMEVVNFI--PGSFVL 219

  Fly   192 DRELKAFLEYGQSFADRLRRA 212
            |..:.|   ..|..|.::|.|
  Fly   220 DSNIAA---RQQQHAQKMREA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 56/216 (26%)
adh_short 7..195 CDD:278532 51/197 (26%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 56/216 (26%)
adh_short 28..229 CDD:278532 52/206 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.