DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and CG4842

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648885.1 Gene:CG4842 / 39817 FlyBaseID:FBgn0036620 Length:259 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:137/257 - (53%) Gaps:11/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLTGKHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTM 67
            ||.||:|.|:...|||..:..:.|:.:.|..|||.....|.|.:|:.:|..|.|.:|:...|:|.
  Fly     2 DLAGKNVVYLGGFGGIGQKCVQELLQRPIKALAIFDLNANEQLLAKWKSQHPDTDVFYHKLDITQ 66

  Fly    68 AREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGG 132
             :.|:...:.....:..:.||::||:.|.::..::.||..||.|::|:..|.|.|||:..||.||
  Fly    67 -KSDIDAAYKATAERFGHFDVVVNGSGLMNDRLVELTIQINLLGVINSTLTALEYMDKAKGGKGG 130

  Fly   133 LIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDREL-- 195
            ||||::||.||.|:.:...|||:|.||..|||::|:|.:|:.:||..:.:|.|    |.|..|  
  Fly   131 LIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYFYAHSGVGFLTICPG----FTDTGLLE 191

  Fly   196 ----KAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYW 253
                |....|.........|...|....|.:|:|:|||.|:||.:.:.:.|....|.:...|
  Fly   192 DIGNKTTFTYDTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGTVLMLEMGETTEVDMPVMW 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 83/246 (34%)
adh_short 7..195 CDD:278532 68/187 (36%)
CG4842NP_648885.1 NADB_Rossmann 6..247 CDD:304358 83/245 (34%)
adh_short 6..194 CDD:278532 69/192 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I2453
eggNOG 1 0.900 - - E2759_KOG4169
Homologene 1 1.000 - - H134459
Inparanoid 1 1.050 136 1.000 Inparanoid score I4534
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008550
OrthoInspector 1 1.000 - - mtm6395
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2961
87.860

Return to query results.
Submit another query.