DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and CG8888

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:82 Identity:23/82 - (28%)
Similarity:33/82 - (40%) Gaps:6/82 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLAD 168
            :::.||.|........||.:.|    ..|.:|.:||.:...||||.....|::..|..|...|..
  Fly   204 SLDLNLLGSARLTQIFLPLVRR----AHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQ 264

  Fly   169 PLYYSQNGVAVMAVCCG 185
            .:  ...||.|..|..|
  Fly   265 EM--RTRGVDVSVVAAG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 23/82 (28%)
adh_short 7..195 CDD:278532 23/82 (28%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 23/82 (28%)
adh_short 96..293 CDD:278532 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.