DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and Cbr4

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_872613.1 Gene:Cbr4 / 359725 RGDID:727826 Length:236 Species:Rattus norvegicus


Alignment Length:253 Identity:69/253 - (27%)
Similarity:113/253 - (44%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VCYV-ADCGGIALETSKVLMTKNIAKLAILQSTENPQAIA-QLQSIKPSTQIFFWTYDVTMARE- 70
            ||.| ....||....::::..|......:.::.|..:|.| :|..|       ...:...:|:| 
  Rat     4 VCAVFGGSRGIGKAVAQLMAQKGYRLAIVARNLEVAKATASELGGI-------HLAFRCNIAKEG 61

  Fly    71 DMKKYFDEVMVQMDYIDVLINGATLCDENNIDAT--------INTNLTGMMNTVATVLPYMDRKM 127
            |:...|:|:...:..::.|:|.|.:..::.:..|        ::|||.|.|.|....:    |.|
  Rat    62 DVHSTFEEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMLSQLHTNLLGTMLTCRAAM----RTM 122

  Fly   128 GGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMA---VCCGPTRV 189
            ...||.||||.|:|||..:....||||:|.|:|||:||||..:...:..|.|:|   :....|:.
  Rat   123 IQQGGSIVNVGSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDMTKH 187

  Fly   190 FVDRELKAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSE-NGQIWIADKGGLEL 246
            ..:...|..:..|: |.:.|..|         ..:|..:|... .|.:.|.| |||:|
  Rat   188 LKEEHFKKNIPLGR-FGEALEVA---------HAVVFLLESPYITGHVLIVD-GGLQL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 69/253 (27%)
adh_short 7..195 CDD:278532 55/199 (28%)
Cbr4NP_872613.1 NADB_Rossmann 3..232 CDD:419666 66/249 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353583
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.