DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and HPGD

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_000851.2 Gene:HPGD / 3248 HGNCID:5154 Length:266 Species:Homo sapiens


Alignment Length:248 Identity:66/248 - (26%)
Similarity:116/248 - (46%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTGKHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQL-----QSIKPSTQIFFWTY 63
            :.||.........||....::.|:.|. ||:|::.  .|.:|..|.     :..:|...:|. ..
Human     3 VNGKVALVTGAAQGIGRAFAEALLLKG-AKVALVD--WNLEAGVQCKAALDEQFEPQKTLFI-QC 63

  Fly    64 DVTMAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMG 128
            ||. .::.::..|.:|:.....:|:|:|.|.:.:|.|.:.|:..||..:::.....|.||.::.|
Human    64 DVA-DQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNG 127

  Fly   129 GTGGLIVNVTSVIGLDP---SPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVF 190
            |.||:|:|::|:.||.|   .||:|   |||.|::|||||.|.......:||.:.|:|.|.....
Human   128 GEGGIIINMSSLAGLMPVAQQPVYC---ASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTA 189

  Fly   191 V------DRELKAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSE-NGQI 236
            :      :..:..::||.....|.::........:....::..||... ||.|
Human   190 ILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 65/245 (27%)
adh_short 7..195 CDD:278532 57/201 (28%)
HPGDNP_000851.2 ADH_SDR_c_like 6..254 CDD:187584 65/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4169
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.