Sequence 1: | NP_001027272.1 | Gene: | Adhr / 3772432 | FlyBaseID: | FBgn0000056 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955903.1 | Gene: | dhrs9 / 322529 | ZFINID: | ZDB-GENE-030131-1249 | Length: | 319 | Species: | Danio rerio |
Alignment Length: | 229 | Identity: | 52/229 - (22%) |
---|---|---|---|
Similarity: | 93/229 - (40%) | Gaps: | 43/229 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 YVADCG-GIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMAREDMKK 74
Fly 75 YFDEV--MVQMDYIDVLINGATLC---------DENNIDATINTNLTGMMNTVATVLPYMDRKMG 128
Fly 129 GTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFV-- 191
Fly 192 ---------------DRELKAFLEYGQSFADRLR 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adhr | NP_001027272.1 | ADH_SDR_c_like | 7..248 | CDD:187584 | 52/229 (23%) |
adh_short | 7..195 | CDD:278532 | 46/212 (22%) | ||
dhrs9 | NP_955903.1 | NADB_Rossmann | 30..307 | CDD:304358 | 52/229 (23%) |
adh_short | 30..211 | CDD:278532 | 45/189 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR43313 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |