DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and Hsd17b6

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001346306.1 Gene:Hsd17b6 / 27400 MGIID:1351670 Length:317 Species:Mus musculus


Alignment Length:137 Identity:39/137 - (28%)
Similarity:56/137 - (40%) Gaps:32/137 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 NLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCA-YSASKFGVIGFTRSLADPLY 171
            ||.|:.....::| ::.:|   ..|.||||:|.:|  ...:|.. ||.||:||..|:..|...: 
Mouse   137 NLIGLTQVTISML-FLVKK---ARGRIVNVSSALG--RVALFGGFYSCSKYGVEAFSDVLRHEV- 194

  Fly   172 YSQNGVAVMAVCCGPTRV-FVDREL-----KAFLE---------YGQSFADRLRRAPCQSTS--- 218
             ...||.|..:..|..:. ..|.||     |...|         |||.|.|..    |.:|.   
Mouse   195 -QDFGVKVSIIEPGSFKTEMTDAELTIERTKKVWEAAPEHIKESYGQQFFDDF----CSTTKREL 254

  Fly   219 -VCGQNI 224
             .|.:|:
Mouse   255 MKCSRNL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 39/137 (28%)
adh_short 7..195 CDD:278532 26/88 (30%)
Hsd17b6NP_001346306.1 NADB_Rossmann 30..306 CDD:389744 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.