DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and SPAC922.06

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_595006.1 Gene:SPAC922.06 / 2543550 PomBaseID:SPAC922.06 Length:258 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:62/221 - (28%)
Similarity:99/221 - (44%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GKHVCYVADCGGIALETSKVL--MTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMA 68
            |:.|......|||.....|:.  :...:|.:.|:..::...|...||:            ||:.|
pombe     5 GRVVLITGAAGGIGKVLCKMFTELGDRVAGIDIVDPSKVQDAALALQA------------DVSKA 57

  Fly    69 REDMKKYFDEVMVQMDYIDVLINGATLCDE--------NNIDATINTNLTGMMNTVATVLPYMDR 125
             :.::...::|:..:..||||||.|.|.|:        .:.|..::..|.|...|...|:|:|.:
pombe    58 -DQIETAIEKVIQTLGPIDVLINNAGLADDTPFEQLSHESWDHDVSLVLRGNYLTQRYVIPHMAK 121

  Fly   126 KMGGTGGLIVNVTSVIG--LDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTR 188
            :  |.||.|||:.||.|  ...||   ||||:|.|:...|::||  :.|...|:.|..  |.|..
pombe   122 Q--GKGGSIVNIGSVNGHIYLGSP---AYSAAKAGLENLTKALA--VRYGPLGIRVNV--CAPGT 177

  Fly   189 VFV---DRELKAFLEYGQSFADRLRR 211
            ::.   |...|...:.|    ||::|
pombe   178 IWSPAWDERFKKHPDVG----DRMKR 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 61/220 (28%)
adh_short 7..195 CDD:278532 56/202 (28%)
SPAC922.06NP_595006.1 PRK07074 6..248 CDD:180823 61/220 (28%)
SDR_c 8..235 CDD:212491 61/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.