DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and Cbr4

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_663570.2 Gene:Cbr4 / 234309 MGIID:2384567 Length:236 Species:Mus musculus


Alignment Length:186 Identity:54/186 - (29%)
Similarity:88/186 - (47%) Gaps:21/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EDMKKYFDEVMVQMDYIDVLINGATLCDENNIDAT--------INTNLTGMMNTVATVLPYMDRK 126
            :|::..|.|:...:..::.|:|.|.:..::.:..|        ::|||.|.|.|....:..|.::
Mouse    61 QDVQSTFQEMEKHLGPVNFLVNAAGINRDSLLVRTKTEDMISQLHTNLLGSMLTCKAAMKTMIQQ 125

  Fly   127 MGGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFV 191
                ||.||||.|:|||..:....||||:|.|::||:||||..:  ::..:.|..|..|..|..:
Mouse   126 ----GGSIVNVGSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEV--ARKKIRVNVVAPGFIRTDM 184

  Fly   192 DRELKAFLEYGQSFADRLRRAPCQSTSVCGQNIVNAIERSE-NGQIWIADKGGLEL 246
            .|.||.     :.|...:.......|......:|..:|... .|.:.|.| |||:|
Mouse   185 TRHLKE-----EHFKKNIPLGRFGETLEVAHAVVFLLESPYITGHVLIVD-GGLQL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 54/186 (29%)
adh_short 7..195 CDD:278532 41/132 (31%)
Cbr4NP_663570.2 fabG 1..234 CDD:235546 53/184 (29%)
NADB_Rossmann 3..232 CDD:304358 51/182 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.