DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and T01G6.1

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_503222.1 Gene:T01G6.1 / 187961 WormBaseID:WBGene00020151 Length:279 Species:Caenorhabditis elegans


Alignment Length:203 Identity:54/203 - (26%)
Similarity:85/203 - (41%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFDLTGKHVCYVADCGGIALETSKVLMTKNIAKLAIL-QSTENPQAIAQ--LQSIKPSTQIFFWT 62
            |....||.|.......||...|: ||..||.|::.|. ::.|..:|..:  |:.:|....:....
 Worm     1 MTRFAGKSVIITGSSSGIGRATA-VLFAKNGAQVTITGRNAEKLEATKKKLLKVVKTPDSVNVVV 64

  Fly    63 YDVTMAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINT-------------NLTGMMN 114
            .::|.| :...:.....:.:...||:|||.|   ..|.:|.|:||             |...::.
 Worm    65 ANLTDA-QGQDQIIQSAVKKFGKIDILINNA---GANVVDGTVNTDQSIDLYHKTFQINFQAVVE 125

  Fly   115 TVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCA--YSASKFGVIGFTRSLADPLYYSQNGV 177
            .|.....|:....|.    ||||:| |...|..|..:  |:|:|..:..:||.:|  |...:.||
 Worm   126 MVKKTKKYLIESKGE----IVNVSS-IAAGPQAVSMSPYYAAAKAALNQYTRCVA--LDLIKQGV 183

  Fly   178 AVMAVCCG 185
            .|.:|..|
 Worm   184 RVNSVSPG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 52/197 (26%)
adh_short 7..195 CDD:278532 52/197 (26%)
T01G6.1NP_503222.1 FabG 3..259 CDD:223959 53/201 (26%)
NADB_Rossmann 4..263 CDD:304358 53/200 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.