Sequence 1: | NP_001027272.1 | Gene: | Adhr / 3772432 | FlyBaseID: | FBgn0000056 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503222.1 | Gene: | T01G6.1 / 187961 | WormBaseID: | WBGene00020151 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 54/203 - (26%) |
---|---|---|---|
Similarity: | 85/203 - (41%) | Gaps: | 30/203 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFDLTGKHVCYVADCGGIALETSKVLMTKNIAKLAIL-QSTENPQAIAQ--LQSIKPSTQIFFWT 62
Fly 63 YDVTMAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATINT-------------NLTGMMN 114
Fly 115 TVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCA--YSASKFGVIGFTRSLADPLYYSQNGV 177
Fly 178 AVMAVCCG 185 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adhr | NP_001027272.1 | ADH_SDR_c_like | 7..248 | CDD:187584 | 52/197 (26%) |
adh_short | 7..195 | CDD:278532 | 52/197 (26%) | ||
T01G6.1 | NP_503222.1 | FabG | 3..259 | CDD:223959 | 53/201 (26%) |
NADB_Rossmann | 4..263 | CDD:304358 | 53/200 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |