DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and C01G12.5

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_497031.1 Gene:C01G12.5 / 182087 WormBaseID:WBGene00007245 Length:279 Species:Caenorhabditis elegans


Alignment Length:274 Identity:71/274 - (25%)
Similarity:111/274 - (40%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGKHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQ-----LQSIKPSTQIFFWTYD 64
            :||.........||...|: :|:.:..||:.|  :..|.|.:.:     |:|..|...:.....|
 Worm     5 SGKVALVTGSSNGIGRATA-ILLAREGAKVTI--TGRNAQRLEETKQEILRSGVPEDHVLSIIAD 66

  Fly    65 VTMAREDMKKYFDEVMVQMDYIDVLIN--GATLCD-ENNI---------DATINTNLTGMMNTVA 117
            :......::.....|.: ...:|:|:|  ||.:.| |.:|         |.|:..||    .:|.
 Worm    67 LATESGQIELMNSTVDI-FGRLDILVNNAGAAITDLEGHIGVGTNVSVFDKTMRINL----RSVV 126

  Fly   118 TVLPYMDRKMGGTGGLIVNVTSVI-GLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMA 181
            |:.......:..|.|.||||:|:. |....|....|:.||..:..:|||.|..|.  |:||.|.:
 Worm   127 TLTQKAKEHLIKTKGEIVNVSSIAGGQHAQPELIYYAMSKSALDQYTRSAAIDLI--QHGVRVNS 189

  Fly   182 VCCGPTRVFVDREL---KAFLEYGQSFADRLRRAPCQSTSVCGQ--NIVNAI----ERSEN---- 233
            |..|..|..:...:   |..:|....|.:  .|..|.......|  ::.|.|    :|..:    
 Worm   190 VSPGDIRTGIYETMGMNKESVENIYKFME--SRKECCPIGTIAQPVDVANIIVFLADRKLSSYII 252

  Fly   234 GQIWIADKGGLELV 247
            ||..:|| ||..||
 Worm   253 GQSIVAD-GGSSLV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 70/272 (26%)
adh_short 7..195 CDD:278532 53/205 (26%)
C01G12.5NP_497031.1 FabG 3..261 CDD:223959 67/268 (25%)
NADB_Rossmann 4..265 CDD:304358 69/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.