DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and dhs-20

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_505941.3 Gene:dhs-20 / 179590 WormBaseID:WBGene00000983 Length:342 Species:Caenorhabditis elegans


Alignment Length:183 Identity:38/183 - (20%)
Similarity:60/183 - (32%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFCAYSASKFGVI 160
            |..|:....::.|..|    |..|.....:.:....|.||.||||.|...:|....|..||||..
 Worm   138 CRMNDYKLALDVNCLG----VIRVTQAFKKLVKAAKGRIVTVTSVNGRLSTPAAGPYVVSKFGAA 198

  Fly   161 GFTRSLADPLYYSQNGVAVMAVCCGPTR-----------------VFVDRELKAFLEYGQSFADR 208
            .:...:...||  ..||.|..:..|..|                 ..:|.|.:.  |||::|   
 Worm   199 AYMDCIRQELY--NFGVKVSILEPGIFRTPLLDEQAMLKRVDHVWTQIDDETRT--EYGETF--- 256

  Fly   209 LRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYWHMADQFVH 261
                                 ::...::|......:...|:|   ::.|.:.|
 Worm   257 ---------------------KNYFAKMWNKTYISMSTTKIH---YVVDNYYH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 34/168 (20%)
adh_short 7..195 CDD:278532 28/115 (24%)
dhs-20NP_505941.3 NADB_Rossmann 42..321 CDD:304358 38/183 (21%)
adh_short 42..230 CDD:278532 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.