DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and SDR9C7

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_683695.1 Gene:SDR9C7 / 121214 HGNCID:29958 Length:313 Species:Homo sapiens


Alignment Length:280 Identity:61/280 - (21%)
Similarity:106/280 - (37%) Gaps:85/280 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLTGKHVCYVADC-GGIALETSKVLMTKNIAKLAILQSTENPQA---------------IAQLQS 51
            :|:.|:| ::..| .|.....:|.|:.:.:..||...:.|..|.               :.:.:|
Human    22 NLSEKYV-FITGCDSGFGNLLAKQLVDRGMQVLAACFTEEGSQKLQRDTSYRLQTTLLDVTKSES 85

  Fly    52 IKPSTQIFFWTYD----------VTMAREDMKKYFDEVMVQMDYIDVLINGATLCDENNIDATIN 106
            ||.:.|   |..|          |..|...:....:|.:.:.|::.|                ||
Human    86 IKAAAQ---WVRDKVGEQGLWALVNNAGVGLPSGPNEWLTKDDFVKV----------------IN 131

  Fly   107 TNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTS------VIGLDPSPVFCAYSASKFGVIGFTRS 165
            .||.|::.....:||.:.|    ..|.:||::|      |||       ..|..|||||..|:.|
Human   132 VNLVGLIEVTLHMLPMVKR----ARGRVVNMSSSGGRVAVIG-------GGYCVSKFGVEAFSDS 185

  Fly   166 LADPLYYSQNGVAVMAVCCGPTRVFV------DRELKAFLE---------YGQS----FADRLRR 211
            :...|||.  ||.|..:..|..|..:      :..::...|         ||:.    :.|:|:.
Human   186 IRRELYYF--GVKVCIIEPGNYRTAILGKENLESRMRKLWERLPQETRDSYGEDYFRIYTDKLKN 248

  Fly   212 APCQSTSVCGQNIVNAIERS 231
            . .|......::::|::|.:
Human   249 I-MQVAEPRVRDVINSMEHA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 60/276 (22%)
adh_short 7..195 CDD:278532 52/225 (23%)
SDR9C7NP_683695.1 type2_17beta_HSD-like_SDR_c 26..302 CDD:187665 60/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.