Sequence 1: | NP_001027272.1 | Gene: | Adhr / 3772432 | FlyBaseID: | FBgn0000056 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536684.2 | Gene: | Rdh1 / 107605 | MGIID: | 1195275 | Length: | 317 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 49/196 - (25%) |
---|---|---|---|
Similarity: | 78/196 - (39%) | Gaps: | 63/196 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 DEVMVQMDYIDVLINGATLCDENNIDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVI 141
Fly 142 GLDPSPVFCAYSASKFGVIGFTRSLADPLYYSQNGVAVMAVCCGPTRVFVDRELKAFLEYGQSFA 206
Fly 207 DRLRRAPCQSTSVCGQNIVNAIERSENGQIWIADKGGLELVKLHWYWHMADQF-VHYMQSNDEED 270
Fly 271 Q 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adhr | NP_001027272.1 | ADH_SDR_c_like | 7..248 | CDD:187584 | 45/170 (26%) |
adh_short | 7..195 | CDD:278532 | 36/117 (31%) | ||
Rdh1 | NP_536684.2 | type2_17beta_HSD-like_SDR_c | 30..306 | CDD:187665 | 49/196 (25%) |
adh_short | 30..211 | CDD:278532 | 35/111 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR43313 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |