DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and Rdh9

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_694773.1 Gene:Rdh9 / 103142 MGIID:2143528 Length:317 Species:Mus musculus


Alignment Length:192 Identity:49/192 - (25%)
Similarity:75/192 - (39%) Gaps:52/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 IAQLQSIKPSTQIFFWTYD----------VTMAREDMKKYFDEVMVQMDYIDVLINGATLCDENN 100
            :.:.:||..:||   |..:          |..|...:....:|.|.:.|:..||           
Mouse    84 VTKTESIVTATQ---WVKERVGNRGLWGLVNNAGISIPSGPNEWMKKQDFAHVL----------- 134

  Fly   101 IDATINTNLTGMMNTVATVLPYMDRKMGGTGGLIVNVTSVIGLDPSPVFC--AYSASKFGVIGFT 163
                 :.||.|::....::||.: ||   ..|.::||.||:|   ....|  ||..||:||..|:
Mouse   135 -----DVNLLGLIEVTLSMLPLV-RK---ARGRVINVASVLG---RVSLCGGAYCISKYGVEAFS 187

  Fly   164 RSLADPLYY------------SQNGVAVMAVCCGPTRVFVDRELKAFLE-YGQSF-ADRLRR 211
            .||...|.|            ...||...|..|..|::..|:......| ||:.: |..|:|
Mouse   188 DSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSNTQMLWDQTSSEIREIYGEKYLASYLKR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 49/192 (26%)
adh_short 7..195 CDD:278532 43/172 (25%)
Rdh9NP_694773.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 49/192 (26%)
adh_short 30..218 CDD:278532 39/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.