DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adhr and XB5957220

DIOPT Version :9

Sequence 1:NP_001027272.1 Gene:Adhr / 3772432 FlyBaseID:FBgn0000056 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031748316.1 Gene:XB5957220 / 100124842 XenbaseID:XB-GENE-5957221 Length:352 Species:Xenopus tropicalis


Alignment Length:284 Identity:62/284 - (21%)
Similarity:97/284 - (34%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KHVCYVADCGGIALETSKVLMTKNIAKLAILQSTENPQAIAQLQSIKPSTQIFFWTYDVTMARE- 70
            |||.......|.....::.|..|....:|...:.:..|.:....|....|.|.    :||.||. 
 Frog    54 KHVLITGCDSGFGNLLAQRLHRKGFGVIAACLTEKGCQDLIACTSPSMKTVIL----NVTNARSI 114

  Fly    71 DMKKYFDEVMVQMDYIDVLINGA---------TLCDENNIDATINTNLTGMMNTVATVLPYMDRK 126
            |....|.........:..|:|.|         ...|..:....::.||.|::......||.:.: 
 Frog   115 DQAVQFVAAETGSKGLYGLVNNAGRATPIGPTDWLDMEDFHRVLDVNLIGLIEVTLKFLPLLKK- 178

  Fly   127 MGGTGGLIVNVTSVIGLDPSPVF--CAYSASKFGVIGFTRSLADPLYYSQNGVAVMAV-----CC 184
               ..|.:|||.||:|   ...|  ..||.||:||..|:.||...:.:.  ||.|..:     ..
 Frog   179 ---ARGRVVNVASVMG---RLAFGGGGYSLSKWGVESFSDSLRRDMQHF--GVKVSIIEPGFFKT 235

  Fly   185 GPTRV-FVDRELKAF---------LEYGQSFADRLRR-----------APCQSTSVCGQNIVNA- 227
            |.|.: .::|:|...         ..||..:.|:..:           |.....:.|.::.:.| 
 Frog   236 GVTNLEVIERDLHRLWNRLTPDIKTAYGDKYFDKYLKVQKLSMNTFCDADISKVTKCMEHALTAR 300

  Fly   228 IERSENGQIWIADKGGLELVKLHW 251
            ..|:..|..|.|        |..|
 Frog   301 FPRTRYGAGWDA--------KFFW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdhrNP_001027272.1 ADH_SDR_c_like 7..248 CDD:187584 60/279 (22%)
adh_short 7..195 CDD:278532 49/205 (24%)
XB5957220XP_031748316.1 NADB_Rossmann 54..331 CDD:419666 62/284 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.