DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG14455

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:166 Identity:31/166 - (18%)
Similarity:71/166 - (42%) Gaps:27/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAHVDIL 72
            |:||.|:..|........:..:.:...|.| |.:..:.:.|::...::.::      .|.|.||.
  Fly    14 FILVALMPLTGAWRSFKVILTSIDFEANDK-FLDLKVDLQNDSGESNLSID------IKTHQDIE 71

  Fly    73 -LRL-------ANAKNFQSMFSQKSDVCAVTSSVKNS--LFKSWFKDMSKNSNFMYNCPVEVGHY 127
             ::|       .:..|:.::.::..:.|.:... :||  |.::.::|:.|:......||:..|.|
  Fly    72 DVQLVVDFGLETDKGNYSTLINRTLNFCKLMKQ-RNSDPLVRAIYEDLLKHGTLFKECPIRSGTY 135

  Fly   128 YMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKL 163
            .:.::.:...|...||...::|         :|.|:
  Fly   136 SLTNYNVDEEMLPSFLPEAKFR---------FGMKI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 17/86 (20%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 17/86 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.