DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG13250

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:147 Identity:29/147 - (19%)
Similarity:49/147 - (33%) Gaps:59/147 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLTLFLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAH 68
            |.|..||.:.|.|..:.:.|.|                    |||..       :||:|:.||..
  Fly    66 LNTFLLLRRSVTKMWVELSVGQ--------------------IANRK-------DRPVQQLFKIR 103

  Fly    69 VD----------------ILLRLANAKNFQSMFSQKSDVCAVTSSVKNSL---------FKSWFK 108
            ||                :|.:|..:.|:       .|.|.:.::|..:.         |.::..
  Fly   104 VDGCHLIEFRSKSRILNAVLHKLLQSGNY-------PDACPLLANVNYTSTRFALNPDHFPAYMP 161

  Fly   109 DMSKNSNFMYNCPVEVG 125
            ||..|:..::.....:|
  Fly   162 DMKFNTKLVFQLSRNMG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 9/55 (16%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.