DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33721

DIOPT Version :10

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:195 Identity:43/195 - (22%)
Similarity:72/195 - (36%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLLTLFLLVQLVFKTEIVVGVSQLFVTGNSSY--NPKY--FKNFTITIANNT-------MNM--- 53
            |...||:||  :|...|:...|:|..|....:  :|.|  |:...|...|.|       .||   
  Fly     4 KAAKLFVLV--IFFGNIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEV 66

  Fly    54 ---DMHLNRPIQRGFKAHVDILLRLANAKNFQSMFSQKSDVC---AVTSSVKNSLFKSWFKDMSK 112
               :......|.|.|::::.|.:            :...|||   |...::.|.:.:.:.:...|
  Fly    67 PITNASAKLQISRRFRSYMPITI------------AASIDVCKYMAYKKNLANPMLRLFEEITKK 119

  Fly   113 NSNFMYNCPVEVGHYYMHDW---RMGSS-MTHKF-----LIPGEY------------RGKLTFFY 156
            .:|..:.||      |.||.   |:.|. ::..|     |.||:|            |..::.:|
  Fly   120 YTNTNHKCP------YDHDLIIDRLPSKYLSEHFTNILPLPPGDYSFNSIWYSRNIERATISIYY 178

  Fly   157  156
              Fly   179  178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 21/101 (21%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 23/103 (22%)

Return to query results.
Submit another query.