DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG13589

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:146 Identity:32/146 - (21%)
Similarity:55/146 - (37%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IVVGVSQLFVTGNS---SYNPKY-------FKNFTITIANNTMNMDMHLNRPIQRGFKAHVDILL 73
            :|.|.:.|....|:   |||..:       .|.::.|  ..::|::.....| .:....|:.::.
  Fly    17 LVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRT--KTSLNINATFIEP-AKNIYLHMKMMK 78

  Fly    74 RLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKN-SNFMYNCPVEVGHYYMHDWRMGSS 137
            :....|.|  :|....|.|..... :|..|.....:|.|| |...:.||.| |...:.|:     
  Fly    79 KANGYKPF--LFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPYE-GLQMLSDF----- 134

  Fly   138 MTHKFLIP-----GEY 148
              |...:|     |:|
  Fly   135 --HHIDVPVPLPSGDY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 19/75 (25%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.