DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG13561

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:131 Identity:26/131 - (19%)
Similarity:43/131 - (32%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KNFT-------ITIANNTMNMDMHLNRPIQRGFKAHVDILLRLANAKNFQSMFSQ---KSDVCAV 94
            :|||       ..:..:.:.|.:..|  |.|..|..|.:.::|....:....|..   :||||..
  Fly    35 ENFTTVSLCRLYAVKRDVVEMSLRAN--ILRWPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEY 97

  Fly    95 TSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKY 159
            ... :|..|.:.......|...:..||:.......|           |..|.:....:...:|.|
  Fly    98 LEK-RNHPFINIILSSFGNRTNVNKCPIPPEIVLEH-----------FRFPVKVLDMMPLPFGDY 150

  Fly   160 G 160
            |
  Fly   151 G 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 16/84 (19%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 16/82 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.