DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33690

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001368948.1 Gene:CG33690 / 3772513 FlyBaseID:FBgn0053690 Length:176 Species:Drosophila melanogaster


Alignment Length:162 Identity:37/162 - (22%)
Similarity:67/162 - (41%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTLFLLVQLVFKTEIVVGVSQLFVTGN-SSYNPKY--FKNFTITIANNT---MNMDMHLNR-PIQ 62
            ::.:|||:.:....::......|...| ||||..:  |....|...|.|   :::...||: || 
  Fly     1 MSKWLLVKFLLTLPMICFCHVTFTNLNCSSYNLDFMSFPTCRIKAVNRTHKYISIYAKLNQVPI- 64

  Fly    63 RGFKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHY 127
              ..|.|.|..|..::.....::....|.|....:.||.|.|::::...:|:|..:.||      
  Fly    65 --VDARVTIQFRRFDSGYKPFLYDLSYDGCKFMKTQKNVLVKTFYRTFQRNTNINHTCP------ 121

  Fly   128 YMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKY 159
            |.||          .::...:.|.|...:|::
  Fly   122 YDHD----------LIVDKLFTGNLEEEFGRF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 16/80 (20%)
CG33690NP_001368948.1 DUF1091 73..153 CDD:399471 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.