DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33630

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:201 Identity:40/201 - (19%)
Similarity:79/201 - (39%) Gaps:43/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WKLLTLFLLVQLVFKT-------------EIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNM 53
            |  ::.|:|::|..:.             :.||.:.|:.|.|.|:|     ....|.|..:..:.
  Fly     8 W--ISAFVLIRLAIEVVGSYYMEYSTSPKKAVVAIKQIHVFGESNY-----MKAKIYIHEDRSHF 65

  Fly    54 DMHLNRPIQRGFK---AHVDILLRLANAKNFQSMFS-QKSDVCAVTSSVK-NSLFKSWFKDMSKN 113
            |:|:....:.|..   .::.:.::...:..|..:|. ::.:.|...|... |.:.:..||...|.
  Fly    66 DLHVQLVHELGSNHLIMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMMFKKNVKL 130

  Fly   114 SNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKLFEE--------ALSL 170
            ::.:. |||.||:|.:    :.|.:.......|...|...||     .::.||        ||.:
  Fly   131 NDIIV-CPVRVGNYSL----LNSDIAENIHADGVQNGTYRFF-----AEIVEEIGEIAKVFALQV 185

  Fly   171 TIDAIL 176
            |.:..:
  Fly   186 TSEVYI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 23/100 (23%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.