DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33912

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:107 Identity:24/107 - (22%)
Similarity:38/107 - (35%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAHVDILLRLANAKNFQSMFSQKSDVCAVT 95
            |.||  ||     ::|..|.:.:      ||.: .|....:..|....|.|  :::...|.|...
  Fly    52 NRSY--KY-----VSIKVNLLKL------PISK-VKIRFGLYKRFTGYKPF--LYNATLDACKFL 100

  Fly    96 SSVKNSLFKSWF--KDM--------SKNSNFMYNCPVEVGHY 127
            .|..::....:|  .|:        |.|:......|...|||
  Fly   101 KSPNSNPVALFFIIHDIVLDKMSYHSVNNKLTKILPFPEGHY 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 12/58 (21%)
CG33912NP_001027139.1 DUF1091 74..144 CDD:284008 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.