DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33647

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:150 Identity:36/150 - (24%)
Similarity:63/150 - (42%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLVQLVFKTEIVVGV---SQLFVTGNS--SYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFK 66
            ||:||.|:..|.|:..|   .::|:|...  :|.|:..:|.:.     .:|...|....|...|.
  Fly     6 LFILVDLILGTLILSSVRAEKEVFMTKIECLNYMPELVRNVSC-----YLNETSHPTGSIYAEFI 65

  Fly    67 AHVDI-------LLRLANAKNFQSMFSQKSDVCAVTSSVKNS-LFKSWFKDMSKNSNFMYNCPVE 123
            ...|:       :|.........:..|...|.|.:.|||:|. ||:.....:.:.:||...||::
  Fly    66 LTQDVEDLKGIYILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCPLK 130

  Fly   124 VGHYYMHDWRMGSSMTHKFL 143
            :...|   :..|.::..||:
  Fly   131 MNKRY---YAKGFTVNSKFI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 17/64 (27%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.