DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33768

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:178 Identity:63/178 - (35%)
Similarity:102/178 - (57%) Gaps:7/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLTLFLLVQLVFKTEIVVGVSQLFVTGN---SSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGF 65
            :|.:..::.::|.::.|    ...||.|   ...|.|:|....:|..|:|:..|:.|.:.::.||
  Fly     1 MLKIVCVLMVIFVSQAV----SSSVTLNRVQCEKNAKFFATLNVTSVNSTIYADIELLQALKAGF 61

  Fly    66 KAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVEVGHYYMH 130
            :.|||:.|||:|||.|||:....:|.|.:.|::|:|||:.|.|.:|||||||.||||..||||:.
  Fly    62 RGHVDVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKNSNFMENCPVPAGHYYLK 126

  Fly   131 DWRMGSSMTHKFLIPGEYRGKLTFFYGKYGTKLFEEALSLTIDAILSN 178
            .|.:...:...:|:.|:|......:||||.:|.....:...::|.:.|
  Fly   127 GWHVEMGLVPSYLLSGDYLLSALVYYGKYRSKKQMFLVRCMVEATMHN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 36/90 (40%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 36/90 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463894
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D73465at7147
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.