DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG13198

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:134 Identity:31/134 - (23%)
Similarity:51/134 - (38%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FTITIANNTMNMDMHLNRPIQRGFKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSL-FKS 105
            |.:.|.|.|..:.....|...|.|..::              :|    |.|.:.:|....| |:.
  Fly    66 FQLPIRNLTTRLQCFQRRDGYRPFMYYI--------------LF----DFCKLMASRNYDLSFER 112

  Fly   106 W-FKDMSKNSNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLTFFYGKYG-----TKLF 164
            : |..:.|.|||...||.:..|..:..:.:..:.....:..|.||...||:  .||     |::|
  Fly   113 FIFDAIRKQSNFNQTCPWKENHMTVEKFALDFTKISMPVPAGTYRLGFTFY--AYGIARTLTQVF 175

  Fly   165 EEAL 168
            .|.:
  Fly   176 FEKI 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 24/96 (25%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.