DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33771 and CG33454

DIOPT Version :9

Sequence 1:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:68/177 - (38%) Gaps:37/177 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLTLFL-LVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTI-----TIANNTMNMDMHLN---- 58
            :|.:|: :|.||:....:|.::.:..       ..|.|:.|:     ..|.:.....:|:|    
  Fly     7 ILGVFVAVVFLVYSDSAMVKMTNVVC-------ESYDKSLTVFHYCRLKAYSRTKTSLHINATFL 64

  Fly    59 RPIQRGFKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKDMSKNSNFMYNCPVE 123
            .|| ........:|.|....|.|  :|....|.|.......|.:.|..:..:...||..::||  
  Fly    65 HPI-NSISVRFQMLKRANGYKPF--LFDITVDACQFLRKPNNPVIKIVYNMIKDASNINHSCP-- 124

  Fly   124 VGHYYMHDWRMGSSMTHKFLIP-----GEYRGKLTFFY-GKYGTKLF 164
            .|...::|:       |:..:|     |:|..:|.|.. ||  ||.:
  Fly   125 YGTVVLNDF-------HRISLPLPFPSGDYLSRLDFLINGK--TKFY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33771NP_001027145.3 DM8 80..171 CDD:214778 22/91 (24%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 18/86 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.