DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and AT1G03070

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001184896.1 Gene:AT1G03070 / 839581 AraportID:AT1G03070 Length:247 Species:Arabidopsis thaliana


Alignment Length:238 Identity:70/238 - (29%)
Similarity:107/238 - (44%) Gaps:28/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GRRREREPMYFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFL------LKHWYIG 64
            |..|...|...|....|..||.:|..|:|..||.|..:.:..||......|.      |..|   
plant    19 GGERSLYPTMLESPELRWGFIRKVYSIIAFQLLATIAVASTVVFVRPIAVFFATTSAGLALW--- 80

  Fly    65 LVGMGIILIFSFMICCCSFLF--RSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAA 127
                 |:||.:.:|..|...:  :..|..|:||.|:.:|.:..|.........|::..|......
plant    81 -----IVLIITPLIVMCPLYYYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVILEAAILTTV 140

  Fly   128 IVVMLCLFARFAP---CDFTGCWIFVFVLSLVVLIMGIVAIFFPTIRI---VYASLGVLLFCVYI 186
            :|:.|.::..:|.   .||.....|:|...:|:::..::.||||..||   :|..|..::||.||
plant   141 VVLSLTVYTFWAAKKGYDFNFLGPFLFGALIVLMVFALIQIFFPLGRISVMIYGCLAAIIFCGYI 205

  Fly   187 VIDVQMIIGGGTHKNEFDESDYVLAAMSLYSDIVFLFLYLLDL 229
            |.|...:|    .:..:||  |:.||:|||.||:.|||.||.:
plant   206 VYDTDNLI----KRYSYDE--YIWAAVSLYLDIINLFLALLTI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 67/228 (29%)
AT1G03070NP_001184896.1 GAAP_like 5..247 CDD:198411 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.