DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and AT4G02690

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_192178.1 Gene:AT4G02690 / 828203 AraportID:AT4G02690 Length:248 Species:Arabidopsis thaliana


Alignment Length:238 Identity:72/238 - (30%)
Similarity:113/238 - (47%) Gaps:24/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGRRREREPMYFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMG 69
            |.||....|...|:...|..||.:|..|:|..||.|..:....|   ..|...|   :....|:|
plant    18 SSRRPLLYPAMHENPELRWGFIRKVYSIIAFQLLATVAVAATVV---TVRPIAL---FFATTGLG 76

  Fly    70 ----IILIFSFMICCCSFLF--RSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAI 128
                |::|.:.:|..|...:  :..|..|:||.|:.||.:.||.........|::..:|...:.:
plant    77 LALYIVIIITPLIVLCPLYYYHQKHPVNYLLLGIFTLALAFVVGLTCAFTNGKVILESVILTSVV 141

  Fly   129 VVMLCLFARFAP---CDFTGCWIFVFVLSLVVLIMGIVAIFFPTIRI---VYASLGVLLFCVYIV 187
            |:.|.|:..:|.   .||.....|:|....|::...::.|.||..|:   :|..|..::||.|||
plant   142 VLSLTLYTFWAARKGYDFNFLGPFLFGALTVLIFFALIQILFPLGRVSVMIYGCLVSIIFCGYIV 206

  Fly   188 IDVQMIIGGGTHKNEFDESDYVLAAMSLYSDIVFLFLYLLDLI 230
            .|...:|    .::.:||  |:.||:|||.||:.||||||.::
plant   207 YDTDNLI----KRHTYDE--YIWAAVSLYLDIINLFLYLLTVL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 68/227 (30%)
AT4G02690NP_192178.1 BI-1-like 31..247 CDD:412397 67/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.