DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and AT4G15470

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_567466.1 Gene:AT4G15470 / 827218 AraportID:AT4G15470 Length:256 Species:Arabidopsis thaliana


Alignment Length:220 Identity:58/220 - (26%)
Similarity:100/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMGIILIFSFMICCCSFLF---- 85
            ||.:|..|::..||:||||....|.:......        |.|...||:|   :|...|:.    
plant    49 FIRKVYGILSAQLLLTTLISAVVVLNPPVNDL--------LTGSPGILLF---LCIVPFILIWPL 102

  Fly    86 ----RSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAP---CDF 143
                :..|...|||.::.::.|..|..:....:.::|..|:....::|..|..:..:|.   .||
plant   103 HIYHQKHPVNLILLALFTVSLSFTVGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDF 167

  Fly   144 TGCWIFVFVLSLVVLIMGIVAIFF---PTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEFDE 205
            :.....:|...:::::...:.:||   ||...||.....|:||.|||.|...:|      ..|..
plant   168 SFLGPILFTSLIILVVTSFIQMFFPLGPTSVAVYGGFSALVFCGYIVYDTDNLI------KRFTY 226

  Fly   206 SDYVLAAMSLYSDIVFLFLYLLDLI 230
            .:|:||:::||.||:.|||.:|.::
plant   227 DEYILASVALYLDILNLFLTILRIL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 58/220 (26%)
AT4G15470NP_567466.1 GAAP_like 16..255 CDD:198411 58/220 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.