DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and AT4G14730

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_193209.2 Gene:AT4G14730 / 827126 AraportID:AT4G14730 Length:235 Species:Arabidopsis thaliana


Alignment Length:236 Identity:64/236 - (27%)
Similarity:114/236 - (48%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGRRREREPMYFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMG 69
            :|...|..|...|....|..||.::..|:::.||||..:.....|.....:|:.: .:.||....
plant     8 TGGGNELYPGMKESSELRWAFIRKLYSILSLQLLVTVGVSAVVYFVRPIPEFITE-THRGLAVFF 71

  Fly    70 IILIFSFMICCCSFLF-RSSPCKYILLVIYVLAHS---TVVCSAAVRYQPKLVFIAVASCAAIVV 130
            :||:...::......| :..|...|:|.|:.|:.|   .:.||.:   |.::|..|....|.:|.
plant    72 VILLLPLLLLWPLLAFEKKHPINCIVLSIFTLSISFSVGICCSLS---QGRIVLEAAILTAVMVF 133

  Fly   131 MLCLFARFA---PCDFTGCWIFVFVLSLVVLIMGIVAIFFPTIRI---VYASLGVLLFCVYIVID 189
            .|.::..:|   ..||:....|:|...|::|:..::.||.|..::   :::.:..::||.||:.|
plant   134 GLTIYTFWAVKRGHDFSFLGPFLFGALLIILVFTLLQIFHPLGKLSSMIFSGIASIVFCGYIIFD 198

  Fly   190 VQMIIGGGTHKNEFDESDYVLAAMSLYSDIVFLFLYLLDLI 230
            ...:|    .|..:||  |:.||:.||.|::.|||.||.:|
plant   199 TNQLI----KKLNYDE--YITAAIRLYLDVMNLFLSLLGII 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 61/225 (27%)
AT4G14730NP_193209.2 BI-1-like 9..235 CDD:320991 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.