DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and Grina

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_075657.1 Gene:Grina / 66168 MGIID:1913418 Length:345 Species:Mus musculus


Alignment Length:241 Identity:69/241 - (28%)
Similarity:117/241 - (48%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PCFSGRRREREPMYFE---------DRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFL 57
            |.....:.|..|.|::         |:..|:.||.:|.:::.:.|.||...:....|....:.|:
Mouse   103 PQHGNYQEEGPPSYYDNQDFPAVNWDKNIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGEVKGFV 167

  Fly    58 LKHWYIGLVGMGIILIFSFMICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAV 122
            .::.:...|...|..|...::.||....|..|...:.|.|..::.|.:|...|..|..:.|.:||
Mouse   168 RENVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAV 232

  Fly   123 ASCAAIVVMLCLFARFAPCDFTGCWIFVFVLSLVVLIMGIVAIFFPT--IRIVYASLGVLLFCVY 185
            ....|:...:.:|:.....|||.|...:.|..:|:.|..|:.||...  :.|||||||.|||..:
Mouse   233 GITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCF 297

  Fly   186 IVIDVQMIIGGGTHKNEFDESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            :.:|.|:::  |..:......:||.||::||:||:.:|||:|.:||
Mouse   298 LAVDTQLLL--GNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 63/225 (28%)
GrinaNP_075657.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 2/11 (18%)
Pro-rich <10..114 CDD:373673 2/10 (20%)
LFG_like 128..341 CDD:198410 63/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831918
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.