DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and LOC566927

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:XP_017213252.1 Gene:LOC566927 / 566927 -ID:- Length:236 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:73/157 - (46%) Gaps:4/157 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSGRRREREPM----YFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIG 64
            ||...|:.|.:    .:|....|..||.:|.:|:|..|.:|:.|:....|....|.|::::..:.
Zfish    78 FSSNLRDAEDVSSTGVWESMSVRHAFIRKVYLILAAQLFITSSIIAVFAFVEPVRLFVIQNPALY 142

  Fly    65 LVGMGIILIFSFMICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIV 129
            .....|.|:...|:.||....|..|...|||.|:.|..|.:..:.:..:..|.||:|:...|.:.
Zfish   143 WASFPIYLVTYLMLVCCEGPRRRHPWNLILLFIFTLTLSYMTGTISSYFDTKAVFLALGITAIVC 207

  Fly   130 VMLCLFARFAPCDFTGCWIFVFVLSLV 156
            |::.:|:.....|||.|...:..|.:|
Zfish   208 VIVTVFSFQTKVDFTSCTGLLCALCVV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 39/141 (28%)
LOC566927XP_017213252.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.