DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and grina

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001016038.1 Gene:grina / 548792 -ID:- Length:366 Species:Xenopus tropicalis


Alignment Length:219 Identity:70/219 - (31%)
Similarity:114/219 - (52%) Gaps:4/219 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMGIILIFSFMIC 79
            ::||:..||.||.:|.:::...||||...:....|...|:.::.::.:...:...|..:....:.
 Frog   146 HWEDKSIRRAFIRKVFLVLTAQLLVTFAFVAVFTFVDEAKVYVRRNTWTYYLSYAIFFVSLITLS 210

  Fly    80 CCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCDFT 144
            ||....|..|...:.|.|...:.|.:|...|..|....|.:|:...||:...:.||:.....|||
 Frog   211 CCGDFRRRHPWNLVALSILTFSLSYMVGMIASFYDTDAVIMAIGITAAVCFTVVLFSLQTKYDFT 275

  Fly   145 GCWIFVFVLSLVVLIMGIVAIFF--PTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEFDESD 207
            .|...:.|..:|:||..|:.||.  ..::|||||||.|||..::.:|.|||:  |..:......:
 Frog   276 SCMGVLLVSLIVLLIFSILCIFIRNKILQIVYASLGALLFTCFLAVDTQMIL--GNKQLSLSPEE 338

  Fly   208 YVLAAMSLYSDIVFLFLYLLDLIG 231
            ||.||::||:||:.:|||:|.:||
 Frog   339 YVFAALNLYTDIINIFLYILAIIG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 68/216 (31%)
grinaNP_001016038.1 Trypan_PARP <40..83 CDD:392002
LFG_like 146..362 CDD:198410 68/217 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.