DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and faim2a

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001013536.1 Gene:faim2a / 541391 ZFINID:ZDB-GENE-050320-88 Length:306 Species:Danio rerio


Alignment Length:226 Identity:68/226 - (30%)
Similarity:118/226 - (52%) Gaps:16/226 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLL--KHWYIG--LVGMGIILIFSF 76
            :||:..||:||.:|..|:.:.|:||..:::...|....|||:.  :.:|:.  :..||..|    
Zfish    84 WEDKNIRRMFIRKVFCILMVQLMVTFSVVSLFTFCEPVRKFVQYNRVFYLTSYMTFMGTYL---- 144

  Fly    77 MICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPC 141
            |:.|.:...|..|...|||.|:.||.|.:....|..:..|:|.::|...|.:.:.:.||...:..
Zfish   145 MLVCSTNARRRYPTNMILLAIFTLAMSYMAGMLASYHNTKVVMLSVGITALVCLAITLFCFQSRV 209

  Fly   142 DFTGCWIFVFVLSLVVLIMGIVAIF------FPTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHK 200
            |||.|...:|.|.:|::|.|::..|      .|.:...||..|.|:|.:::..|:|::|  |..:
Zfish   210 DFTTCHGLLFSLMMVLMITGLLLFFTAPFGYIPWLHTAYAGFGALVFTLFLAFDMQLLI--GNRR 272

  Fly   201 NEFDESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            ...:..::|..|:.||.|:|::||:.|.|.|
Zfish   273 YSLNPEEHVFGAICLYMDVVYIFLFFLQLFG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 67/224 (30%)
faim2aNP_001013536.1 LFG_like 83..303 CDD:198410 67/224 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.