DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and TMBIM4

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001269535.1 Gene:TMBIM4 / 51643 HGNCID:24257 Length:285 Species:Homo sapiens


Alignment Length:223 Identity:57/223 - (25%)
Similarity:103/223 - (46%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKF------LLKHWYIGLVGMGIILIFSFMI 78
            |....|:.:|..|:::.:|:||:..|..::....|.|      |:..:.:|.:|    |||:.::
Human    76 YKGPTFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLG----LIFALIL 136

  Fly    79 CCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCDF 143
            ....:     |....||..:.|..:..|......|...::..|......:...|.::...:..||
Human   137 NRHKY-----PLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDF 196

  Fly   144 TGCWIFVFVLSLVVLIMGIVAIFF--PTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEFDES 206
            :.....:|.|..::.:.|.:..||  ..:.:|.|:.|.||||.:|:.|...::    ||  ....
Human   197 SKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLM----HK--LSPE 255

  Fly   207 DYVLAAMSLYSDIVFLFLYLLDLIGLID 234
            :|||||:|||.||:.|||:||..:..::
Human   256 EYVLAAISLYLDIINLFLHLLRFLEAVN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 57/218 (26%)
TMBIM4NP_001269535.1 GAAP_like 6..283 CDD:198411 57/221 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.