DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and Mics1

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster


Alignment Length:209 Identity:35/209 - (16%)
Similarity:72/209 - (34%) Gaps:82/209 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WYIGLVGMGIILIFSFMICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPK--------L 117
            |...||.:|::::...:                              :..:.|||.        |
  Fly   180 WVASLVTLGLVMLSGSI------------------------------AQGLEYQPGFGAKQLAWL 214

  Fly   118 VFIAVASCAAIVVMLCLF----------------------ARFAPCDFTGCWIFVFVLSLVVLIM 160
            |..||  ..|::..:||.                      |..||.:     .|:.:...:.:.:
  Fly   215 VHCAV--LGAVLAPMCLLGGPILTKALLYTSGIVGALSTVAACAPSE-----KFLHMGGPLAIGL 272

  Fly   161 GIV------AIFFPTIRIVYASL-------GVLLFCVYIVIDVQMIIGGGTHKNEFDESDY--VL 210
            |:|      :::.|....|.|.|       |::||..:::.|.|.|:.......::.:..|  :.
  Fly   273 GVVFASSLASMWLPPTTAVGAGLASMSLYGGLILFSGFLLYDTQRIVKSAELYPQYSKFPYDPIN 337

  Fly   211 AAMSLYSDIVFLFL 224
            .|:::|.|.:.:|:
  Fly   338 HALAIYMDALNIFI 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 35/209 (17%)
Mics1NP_649725.2 GHITM 116..364 CDD:198413 35/209 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.