DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and tmbim4

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_998303.2 Gene:tmbim4 / 406412 ZFINID:ZDB-GENE-040426-2152 Length:236 Species:Danio rerio


Alignment Length:222 Identity:57/222 - (25%)
Similarity:102/222 - (45%) Gaps:33/222 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKH---WYIGLVGMGIILIFSFMICCCSF 83
            |..|:.:|..|:::.:::||.:....:.....:.|:.:.   ..|..:|..|:|:      ..:|
Zfish    29 RMDFLRKVYTILSLQIIITTAVSALFMLCNPIKNFVHESPSLVLISAIGSLILLL------ALAF 87

  Fly    84 LFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCL--------FARFAP 140
            .....|....||..:.|..|..|.:|...|:..:|..|....:|:.:.|..        |::...
Zfish    88 YRHQHPVNLYLLFGFTLLESLSVATAVSFYEYTIVLQAFVLTSAVFLGLTAYTFQSKRDFSKLGA 152

  Fly   141 CDFTGCWIFVFVLSLVVLIMGIVAIFF--PTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEF 203
            ..|.|.||        ::|...:..||  .|:.:|:|..|.||||.:|:.|..:::    ||  .
Zfish   153 SLFAGLWI--------LIIASFLRFFFYNDTMELVFAGAGALLFCGFIIFDTHLLM----HK--L 203

  Fly   204 DESDYVLAAMSLYSDIVFLFLYLLDLI 230
            ...::|||:::||.|||.||||:|.::
Zfish   204 SPEEHVLASINLYLDIVNLFLYILRIL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 57/222 (26%)
tmbim4NP_998303.2 GAAP_like 4..233 CDD:198411 57/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.