DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and Tmbim4

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_954547.1 Gene:Tmbim4 / 362884 RGDID:735173 Length:238 Species:Rattus norvegicus


Alignment Length:250 Identity:66/250 - (26%)
Similarity:115/250 - (46%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EREPMY----FEDRYS------------RRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKF-- 56
            :.:|.|    .||.::            |..|:.:|..|:::.:|:||:.....::....|.|  
  Rat     3 DTDPRYPRSSIEDDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFETLRTFVH 67

  Fly    57 ----LLKHWYIGLVGMGIILIFSFMICCCSFLFR-SSPCKYILLVIYVLAHSTVVCSAAVRYQPK 116
                |:..:.:|.:|    |||:..      |.| :.|....||..:.|:.:..|.:....|...
  Rat    68 DSPALIVVFALGSLG----LIFALT------LHRHTHPLNLYLLFAFTLSEALTVATVVTFYDGH 122

  Fly   117 LVFIAVASCAAIVVMLCLFARFAPCDFTGCWIFVFVLSLVVLIMGIVAIFF--PTIRIVYASLGV 179
            ||..|....||:.:.|..:...:..||:.....:|....::.:.|.:.:||  .|:.:|.||||.
  Rat   123 LVLHAFILTAAVFLGLTAYTLQSKRDFSKFGAGLFACLWILCLAGFLKVFFYSQTVELVLASLGA 187

  Fly   180 LLFCVYIVIDVQMIIGGGTHKNEFDESDYVLAAMSLYSDIVFLFLYLLDLIGLID 234
            ||||.:|:.|...::      :.....:|||||:|||.||:.|||:||..:..::
  Rat   188 LLFCGFIIYDTHSLM------HRLSPEEYVLAAISLYLDIINLFLHLLKFLDAVN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 64/235 (27%)
Tmbim4NP_954547.1 GAAP_like 6..236 CDD:198411 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2042
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.