DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and Tmbim1

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 / 316516 RGDID:1359409 Length:309 Species:Rattus norvegicus


Alignment Length:225 Identity:64/225 - (28%)
Similarity:115/225 - (51%) Gaps:8/225 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PMYFEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMGIILIFSFM 77
            |..::||..|..||.:|..|:::.||:|..|:....|.....:::..:..:..|...:.::...:
  Rat    84 PGEWDDRKVRHTFIQKVYCIISVQLLITVAIIAVFTFVEPVSEYVRSNVAVYYVSYAVFIVTYLI 148

  Fly    78 ICCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCD 142
            :.||....|..|...|||.|:.||...:..:.:..|:.|.|.||:...|.:.:.:.:|......|
  Rat   149 LVCCQGPRRRFPWNIILLTIFTLALGFMTGAISSMYETKAVIIAMIITAVVSISVTIFCFQTKVD 213

  Fly   143 FTGCWIFVFVLSLVVLIMGI---VAIFFPTI---RIVYASLGVLLFCVYIVIDVQMIIGGGTHKN 201
            ||.|...:.||.:|:.:.|.   |.:||..|   .:|||.||.:.|.:::..|.|:::  |..|:
  Rat   214 FTSCTGLICVLGIVLAVTGAVTSVVLFFEYIYWLHMVYAGLGAICFTLFLAYDTQLVL--GNRKH 276

  Fly   202 EFDESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            .....||:..|:.:|:|||::|.::|.|:|
  Rat   277 TISPEDYITGALQIYTDIVYIFTFVLQLVG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 62/220 (28%)
Tmbim1NP_001007714.1 LFG_like 87..306 CDD:198410 62/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.