DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33673 and Faim2

DIOPT Version :9

Sequence 1:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_653357.1 Gene:Faim2 / 246274 RGDID:628744 Length:316 Species:Rattus norvegicus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:108/224 - (48%) Gaps:12/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEDRYSRRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKH--WYIGLVGMGIILIFSFMI 78
            ::|:..|::||.:|..|:.:.||||..::....|....:.::..:  ||  .....:.......:
  Rat    93 WDDQKVRQLFIRKVYTILLVQLLVTLAVVALFTFCDVVKDYVQANPGWY--WASYAVFFATYLTL 155

  Fly    79 CCCSFLFRSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCDF 143
            .|||...|..|...|||.|:.|:.:.:....:..|....|.:.:...|.:.:.:.:|:.....||
  Rat   156 ACCSGPRRHFPWNLILLTIFTLSMAYLTGMLSSYYNTTSVLLCLGITALVCLSVTIFSFQTKFDF 220

  Fly   144 TGCWIFVFVLSLVVLIMG-IVAI-----FFPTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNE 202
            |.|...:|||.:.:...| ::||     :.|.:..|||.||..:|.:::..|.|:::|...|  .
  Rat   221 TSCHGVLFVLLMTLFFSGLLLAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRH--S 283

  Fly   203 FDESDYVLAAMSLYSDIVFLFLYLLDLIG 231
            ....:|:..|:::|.||:::|.:.|.|.|
  Rat   284 LSPEEYIFGALNIYLDIIYIFTFFLQLFG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 56/222 (25%)
Faim2NP_653357.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
LFG_like 92..312 CDD:198410 56/222 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.